SCOPe 2.06: Domain d3s48a_: 3s48 A:

Lineage for d3s48a_ (3s48 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein automated matches [191246] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282459] [226200] (2 PDB entries)

8. Domain d3s48a_: 3s48 A: [249295]
   Other proteins in same PDB: d3s48c_, d3s48d_
   automated match to d3ovub_
   complexed with hem

Details for d3s48a_

PDB Entry: 3s48, 3.05 Å

PDB Description: Human Alpha-Haemoglobin Complexed with the First NEAT Domain of IsdH from Staphylococcus aureus

PDB Compounds: (A:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3s48a_:

Sequence; same for both SEQRES and ATOM records:

>d3s48a_ b.1.28.1 (A:) automated matches {Staphylococcus aureus [TaxId: 282459]}
deslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkaev
eldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqidd
geetnydytklvfakpiyndpsl

Timeline for d3s48a_:

• d3s48a_ first appeared in SCOPe 2.04
  
• d3s48a_ appears in SCOPe 2.05
  
• d3s48a_ appears in SCOPe 2.07
  
• d3s48a_ appears in the current release, SCOPe 2.08