Lineage for d3s0pf_ (3s0p F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037424Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2037425Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2037957Protein automated matches [190916] (10 species)
    not a true protein
  7. 2037979Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries)
  8. 2037990Domain d3s0pf_: 3s0p F: [249258]
    automated match to d3hoga_
    complexed with cu

Details for d3s0pf_

PDB Entry: 3s0p (more details), 3 Å

PDB Description: Copper-reconstituted Tomato Chloroplast Superoxide Dismutase
PDB Compounds: (F:) Superoxide dismutase [Cu-Zn], chloroplastic

SCOPe Domain Sequences for d3s0pf_:

Sequence, based on SEQRES records: (download)

>d3s0pf_ b.1.8.1 (F:) automated matches {Solanum lycopersicum [TaxId: 4081]}
tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
ahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvhe
leddlgkgghelslttgnaggrlacgvvgltpi

Sequence, based on observed residues (ATOM records): (download)

>d3s0pf_ b.1.8.1 (F:) automated matches {Solanum lycopersicum [TaxId: 4081]}
tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
ahfnpagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvheledggrlacgvvgl
tpi

SCOPe Domain Coordinates for d3s0pf_:

Click to download the PDB-style file with coordinates for d3s0pf_.
(The format of our PDB-style files is described here.)

Timeline for d3s0pf_: