SCOPe 2.08: Domain d3rv2b3: 3rv2 B:253-403

Lineage for d3rv2b3 (3rv2 B:253-403)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Mycobacterium marinum [TaxId:216594] [256066] (1 PDB entry)

8. Domain d3rv2b3: 3rv2 B:253-403 [249226]
   automated match to d1mxaa3
   complexed with ca, edo, gol

Details for d3rv2b3

PDB Entry: 3rv2, 2 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase from mycobacterium marinum

PDB Compounds: (B:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d3rv2b3:

Sequence; same for both SEQRES and ATOM records:

>d3rv2b3 d.130.1.0 (B:253-403) automated matches {Mycobacterium marinum [TaxId: 216594]}
lggpmgdagltgrkiivdtyggwarhgggafsgkdpskvdrsaayamrwvaknvvaagla
ervevqvayaigkaapvglfvetfgseavdpvkiekaigevfdlrpgaiirdlnllrpiy
aptaayghfgrtdvdlpwerldkvddlkrai

Timeline for d3rv2b3:

• d3rv2b3 first appeared in SCOPe 2.04
  
• d3rv2b3 appears in SCOPe 2.07