| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
| Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
| Protein automated matches [254617] (15 species) not a true protein |
| Species Mycobacterium marinum [TaxId:216594] [256066] (1 PDB entry) |
| Domain d3rv2a2: 3rv2 A:133-252 [249222] automated match to d1rg9a2 complexed with ca, edo, gol |
PDB Entry: 3rv2 (more details), 2 Å
SCOPe Domain Sequences for d3rv2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rv2a2 d.130.1.0 (A:133-252) automated matches {Mycobacterium marinum [TaxId: 216594]}
gdqglmfgyaindtpelmplpialahrlsrrltevrkngvlpylrpdgktqvtiayedrv
pvrldtvvistqhaddidlvktldpdireqvlktvlddlahdtldasavrvlvnptgkfv
Timeline for d3rv2a2: