Lineage for d3rnud2 (3rnu D:673-766)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2061233Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) (S)
    duplication: tandem repeat of two OB-fold domains
  5. 2061234Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein)
    Pfam PF02760
  6. 2061235Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species)
  7. 2061236Species Human (Homo sapiens) [TaxId:9606] [159144] (6 PDB entries)
    Uniprot Q16666 199-301! Uniprot Q16666 302-389
  8. 2061260Domain d3rnud2: 3rnu D:673-766 [249200]
    Other proteins in same PDB: d3rnua3, d3rnub3, d3rnub4, d3rnuc3, d3rnud3
    automated match to d3rloa2
    protein/DNA complex; complexed with edo, fmt

Details for d3rnud2

PDB Entry: 3rnu (more details), 2.5 Å

PDB Description: Structural Basis of Cytosolic DNA Sensing by Innate Immune Receptors
PDB Compounds: (D:) Gamma-interferon-inducible protein 16

SCOPe Domain Sequences for d3rnud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnud2 b.40.16.1 (D:673-766) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
pkinqlcsqtkgsfvngvfevhkknvrgeftyyeiqdntgkmevvvhgrlttinceegdk
lkltcfelapksgntgelrsvihshikviktrkn

SCOPe Domain Coordinates for d3rnud2:

Click to download the PDB-style file with coordinates for d3rnud2.
(The format of our PDB-style files is described here.)

Timeline for d3rnud2: