SCOPe 2.05: Domain d3rglb_: 3rgl B:

Lineage for d3rglb_ (3rgl B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein automated matches [193659] (5 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [256056] (2 PDB entries)

8. Domain d3rglb_: 3rgl B: [249085]
   automated match to d1j5wa_
   protein/RNA complex; complexed with atp, gly, lmr

Details for d3rglb_

PDB Entry: 3rgl, 2.45 Å

PDB Description: The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP and glycine

PDB Compounds: (B:) Glycyl-tRNA synthetase alpha subunit

SCOPe Domain Sequences for d3rglb_:

Sequence; same for both SEQRES and ATOM records:

>d3rglb_ d.104.1.1 (B:) automated matches {Campylobacter jejuni [TaxId: 197]}
namtfsqmilnlqnywqeqgcaimqpydmpagagtfhpatflrslgkkpwaaayvapsrr
ptdgrygenpnrlgayyqfqvlikpspdniqelylkslenlgfdlkshdirfvednwesp
slgawglgwevwldgmevtqftyfqqvggiavdlvsaeitygleriamylqnvdnvydiv
wsefngekikyadvhkqseyefskynfevsdvkilneqfensykecknileqglalpayd
ycmlaahtfnlldargaisvaqrqdymlkirelskncaeiykknln

Timeline for d3rglb_:

• d3rglb_ first appeared in SCOPe 2.04
  
• d3rglb_ is called d3rglb1 in SCOPe 2.06
  
• d3rglb_ appears in the current release, SCOPe 2.08, called d3rglb1