SCOPe 2.04: Domain d3r9gb_: 3r9g B:

Lineage for d3r9gb_ (3r9g B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (28 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [233422] (5 PDB entries)

8. Domain d3r9gb_: 3r9g B: [249078]
   automated match to d3r95a_
   complexed with 7mc, coa

Details for d3r9gb_

PDB Entry: 3r9g, 1.35 Å

PDB Description: crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and processed microcin c7 antibiotic

PDB Compounds: (B:) MccE protein

SCOPe Domain Sequences for d3r9gb_:

Sequence; same for both SEQRES and ATOM records:

>d3r9gb_ d.108.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
gikvndeitllypalkyaeelyllinqnkinfiksmawpafvnnisdsvsfieqsmidnq
nekalilfikyktkiagvvsfniidhanktayigywlganfqgkgivtnainkliqeygd
sgvikrfvikcivdnkksnatalrcgftlegvlqkaeilngvsydqniyskvi

Timeline for d3r9gb_:

• d3r9gb_ is new in SCOPe 2.04-stable
  
• d3r9gb_ appears in SCOPe 2.05
  
• d3r9gb_ appears in the current release, SCOPe 2.08