Lineage for d3r9gb_ (3r9g B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664807Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1664808Protein automated matches [190038] (28 species)
    not a true protein
  7. 1664843Species Escherichia coli [TaxId:562] [233422] (5 PDB entries)
  8. 1664851Domain d3r9gb_: 3r9g B: [249078]
    automated match to d3r95a_
    complexed with 7mc, coa

Details for d3r9gb_

PDB Entry: 3r9g (more details), 1.35 Å

PDB Description: crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and processed microcin c7 antibiotic
PDB Compounds: (B:) MccE protein

SCOPe Domain Sequences for d3r9gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r9gb_ d.108.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
gikvndeitllypalkyaeelyllinqnkinfiksmawpafvnnisdsvsfieqsmidnq
nekalilfikyktkiagvvsfniidhanktayigywlganfqgkgivtnainkliqeygd
sgvikrfvikcivdnkksnatalrcgftlegvlqkaeilngvsydqniyskvi

SCOPe Domain Coordinates for d3r9gb_:

Click to download the PDB-style file with coordinates for d3r9gb_.
(The format of our PDB-style files is described here.)

Timeline for d3r9gb_: