Lineage for d1ltsg_ (1lts G:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540282Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1540406Protein Heat-labile toxin [50205] (2 species)
  7. 1540407Species Escherichia coli, type IB [TaxId:562] [50206] (21 PDB entries)
  8. 1540461Domain d1ltsg_: 1lts G: [24903]
    Other proteins in same PDB: d1lts.1

Details for d1ltsg_

PDB Entry: 1lts (more details), 1.95 Å

PDB Description: refined structure of e. coli heat labile enterotoxin, a close relative of cholera toxin
PDB Compounds: (G:) heat-labile enterotoxin, subunit b

SCOPe Domain Sequences for d1ltsg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltsg_ b.40.2.1 (G:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOPe Domain Coordinates for d1ltsg_:

Click to download the PDB-style file with coordinates for d1ltsg_.
(The format of our PDB-style files is described here.)

Timeline for d1ltsg_: