Lineage for d1eefp_ (1eef P:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1123908Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 1123909Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1124033Protein Heat-labile toxin [50205] (2 species)
  7. 1124034Species Escherichia coli, type IB [TaxId:562] [50206] (21 PDB entries)
  8. 1124059Domain d1eefp_: 1eef P: [24889]
    complexed with gla, i06

Details for d1eefp_

PDB Entry: 1eef (more details), 1.8 Å

PDB Description: heat-labile enterotoxin b-pentamer complexed with bound ligand pepg
PDB Compounds: (P:) protein (heat-labile enterotoxin b chain)

SCOPe Domain Sequences for d1eefp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eefp_ b.40.2.1 (P:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOPe Domain Coordinates for d1eefp_:

Click to download the PDB-style file with coordinates for d1eefp_.
(The format of our PDB-style files is described here.)

Timeline for d1eefp_: