Lineage for d3pxja2 (3pxj A:131-230)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365546Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255699] (2 PDB entries)
  8. 2365550Domain d3pxja2: 3pxj A:131-230 [248720]
    automated match to d2v9ta_

Details for d3pxja2

PDB Entry: 3pxj (more details), 2.3 Å

PDB Description: tandem ig repeats of dlar
PDB Compounds: (A:) Tyrosine-protein phosphatase Lar

SCOPe Domain Sequences for d3pxja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pxja2 b.1.1.0 (A:131-230) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
egdktpagfpvitqgpgtrvievghtvlmtckaignptpniywiknqtkvdmsnpryslk
dgflqiensreedqgkyecvaensmgtehskatnlyvkvr

SCOPe Domain Coordinates for d3pxja2:

Click to download the PDB-style file with coordinates for d3pxja2.
(The format of our PDB-style files is described here.)

Timeline for d3pxja2: