Lineage for d1efif_ (1efi F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540282Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1540406Protein Heat-labile toxin [50205] (2 species)
  7. 1540407Species Escherichia coli, type IB [TaxId:562] [50206] (21 PDB entries)
  8. 1540415Domain d1efif_: 1efi F: [24872]
    complexed with gat

Details for d1efif_

PDB Entry: 1efi (more details), 1.6 Å

PDB Description: heat-labile enterotoxin b-pentamer complexed with para-aminophenyl- alpha-d-galactopyranoside
PDB Compounds: (F:) protein (heat-labile enterotoxin b chain)

SCOPe Domain Sequences for d1efif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efif_ b.40.2.1 (F:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOPe Domain Coordinates for d1efif_:

Click to download the PDB-style file with coordinates for d1efif_.
(The format of our PDB-style files is described here.)

Timeline for d1efif_: