Lineage for d3px6a1 (3px6 A:298-468)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2140276Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2140277Protein automated matches [190396] (35 species)
    not a true protein
  7. 2140302Species Geobacillus kaustophilus [TaxId:1462] [233272] (8 PDB entries)
  8. 2140305Domain d3px6a1: 3px6 A:298-468 [248713]
    Other proteins in same PDB: d3px6a2, d3px6d2
    automated match to d3pv8d1
    protein/DNA complex; complexed with dct, mn, so4

Details for d3px6a1

PDB Entry: 3px6 (more details), 1.59 Å

PDB Description: crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (tautomer) in closed conformation
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d3px6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3px6a1 c.55.3.0 (A:298-468) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf
vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk
qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d3px6a1:

Click to download the PDB-style file with coordinates for d3px6a1.
(The format of our PDB-style files is described here.)

Timeline for d3px6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3px6a2