SCOPe 2.04: Domain d3pv0b1: 3pv0 B:2-235

Lineage for d3pv0b1 (3pv0 B:2-235)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)

7. Species Escherichia coli [TaxId:562] [102380] (15 PDB entries)

8. Domain d3pv0b1: 3pv0 B:2-235 [248668]
   Other proteins in same PDB: d3pv0a2, d3pv0b2, d3pv0e_, d3pv0f1, d3pv0f2, d3pv0g_
   automated match to d3rlfa1
   complexed with mal, pgv

Details for d3pv0b1

PDB Entry: 3pv0, 3.1 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide

PDB Compounds: (B:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3pv0b1:

Sequence; same for both SEQRES and ATOM records:

>d3pv0b1 c.37.1.12 (B:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

Timeline for d3pv0b1:

• d3pv0b1 is new in SCOPe 2.04-stable
  
• d3pv0b1 appears in SCOPe 2.05
  
• d3pv0b1 appears in the current release, SCOPe 2.08