Lineage for d2sob__ (2sob -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) 
Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein) Protein Staphylococcal nuclease [50201] (1 species) Species Staphylococcus aureus [TaxId:1280] [50202] (56 PDB entries) 
Domain d2sob__: 2sob - [24864]
Details for d2sob__
PDB Entry: 2sob (more details)
PDB Description: sn-ob, ob-fold sub-domain of staphylococcal nuclease, nmr, 10 structures
SCOP Domain Sequences for d2sob__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sob__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmlenakkievefdkgqrtdkygrvlayiyadgkmvneal
SCOP Domain Coordinates for d2sob__:
Click to download the PDB-style file with coordinates for d2sob__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2sob__:
- d2sob__ first appeared (with stable ids) in SCOP 1.55
- d2sob__ appears in SCOP 1.57
- d2sob__ appears in SCOP 1.61
- d2sob__ appears in the current release, SCOPe 2.08, called d2soba_
View in 3D