SCOPe 2.08: Domain d1nsns_: 1nsn S:

Lineage for d1nsns_ (1nsn S:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (268 PDB entries)
   Uniprot P00644 89-223

8. Domain d1nsns_: 1nsn S: [24863]
   Other proteins in same PDB: d1nsnh1, d1nsnh2, d1nsnl1, d1nsnl2

Details for d1nsns_

PDB Entry: 1nsn, 2.8 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution

PDB Compounds: (S:) staphylococcal nuclease

SCOPe Domain Sequences for d1nsns_:

Sequence; same for both SEQRES and ATOM records:

>d1nsns_ b.40.1.1 (S:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
tkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftk
kmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheq
hlrkseaqakkeklniws

Timeline for d1nsns_:

• d1nsns_ first appeared (with stable ids) in SCOP 1.55
  
• d1nsns_ appears in SCOPe 2.07