Lineage for d1nsns_ (1nsn S:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13575Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 13576Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
  6. 13577Protein Staphylococcal nuclease [50201] (1 species)
  7. 13578Species Staphylococcus aureus [TaxId:1280] [50202] (52 PDB entries)
  8. 13630Domain d1nsns_: 1nsn S: [24863]
    Other proteins in same PDB: d1nsnh1, d1nsnh2, d1nsnl1, d1nsnl2

Details for d1nsns_

PDB Entry: 1nsn (more details), 2.9 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution

SCOP Domain Sequences for d1nsns_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsns_ b.40.1.1 (S:) Staphylococcal nuclease {Staphylococcus aureus}
tkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftk
kmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheq
hlrkseaqakkeklniws

SCOP Domain Coordinates for d1nsns_:

Click to download the PDB-style file with coordinates for d1nsns_.
(The format of our PDB-style files is described here.)

Timeline for d1nsns_: