| Class b: All beta proteins [48724] (177 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
| Protein automated matches [191144] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189286] (21 PDB entries) |
| Domain d3p8hc1: 3p8h C:206-313 [248447] automated match to d1oz3a1 complexed with gol, p8h, so4 |
PDB Entry: 3p8h (more details), 2.55 Å
SCOPe Domain Sequences for d3p8hc1:
Sequence, based on SEQRES records: (download)
>d3p8hc1 b.34.9.0 (C:206-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaevcg
yrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeee
>d3p8hc1 b.34.9.0 (C:206-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaevcg
yrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgyke
Timeline for d3p8hc1: