| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
| Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
| Protein automated matches [254461] (3 species) not a true protein |
| Species Escherichia coli [TaxId:701177] [256012] (2 PDB entries) |
| Domain d3p4sc_: 3p4s C: [248422] Other proteins in same PDB: d3p4sb1, d3p4sb2, d3p4sn1, d3p4sn2 automated match to d3p4pc_ complexed with 3np, f3s, fad, fes, sf4 |
PDB Entry: 3p4s (more details), 3.1 Å
SCOPe Domain Sequences for d3p4sc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p4sc_ f.21.2.2 (C:) automated matches {Escherichia coli [TaxId: 701177]}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw
Timeline for d3p4sc_: