Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein automated matches [231469] (4 species) not a true protein |
Species Escherichia coli [TaxId:216592] [256014] (2 PDB entries) |
Domain d3p4rn2: 3p4r N:106-243 [248418] Other proteins in same PDB: d3p4rb1, d3p4rc_, d3p4rn1, d3p4ro_ automated match to d3p4pb2 complexed with f3s, fad, fes, gua, sf4 |
PDB Entry: 3p4r (more details), 3.05 Å
SCOPe Domain Sequences for d3p4rn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p4rn2 a.1.2.1 (N:106-243) automated matches {Escherichia coli [TaxId: 216592]} mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq qgkvesskdfliatlkpr
Timeline for d3p4rn2:
View in 3D Domains from other chains: (mouse over for more information) d3p4rb1, d3p4rb2, d3p4rc_, d3p4ro_ |