SCOPe 2.04: Domain d3p4rn1: 3p4r N:1-105

Lineage for d3p4rn1 (3p4r N:1-105)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein automated matches [231466] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:216592] [256013] (2 PDB entries)

8. Domain d3p4rn1: 3p4r N:1-105 [248417]
   Other proteins in same PDB: d3p4rb2, d3p4rc_, d3p4rn2, d3p4ro_
   automated match to d3p4pb1
   complexed with f3s, fad, fes, gua, sf4

Details for d3p4rn1

PDB Entry: 3p4r, 3.05 Å

PDB Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with glutarate

PDB Compounds: (N:) Fumarate reductase iron-sulfur subunit

SCOPe Domain Sequences for d3p4rn1:

Sequence; same for both SEQRES and ATOM records:

>d3p4rn1 d.15.4.2 (N:1-105) automated matches {Escherichia coli [TaxId: 216592]}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

Timeline for d3p4rn1:

• d3p4rn1 is new in SCOPe 2.04-stable
  
• d3p4rn1 appears in SCOPe 2.05
  
• d3p4rn1 appears in the current release, SCOPe 2.08