SCOPe 2.07: Domain d3ot4g_: 3ot4 G:

Lineage for d3ot4g_ (3ot4 G:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (25 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [256004] (2 PDB entries)

8. Domain d3ot4g_: 3ot4 G: [248329]
   automated match to d3hb7a_

Details for d3ot4g_

PDB Entry: 3ot4, 2.4 Å

PDB Description: Structure and Catalytic Mechanism of Bordetella bronchiseptica nicF

PDB Compounds: (G:) Putative isochorismatase

SCOPe Domain Sequences for d3ot4g_:

Sequence; same for both SEQRES and ATOM records:

>d3ot4g_ c.33.1.0 (G:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
yerqgfgaalplkapygllivdfvngfadpaqfgggniaaaiettrtvlaaarergwava
hsrivyadddadgnifsikvpgmltlkehapasaivpqlapqageyvvrkstpsafygtm
laawlaqrgvqtllvagattsgcvrasvvdamsagfrplvlsdcvgdralgpheanlfdm
rqkyaavmthdealakt

Timeline for d3ot4g_:

• d3ot4g_ first appeared in SCOPe 2.04
  
• d3ot4g_ appears in SCOPe 2.06
  
• d3ot4g_ appears in the current release, SCOPe 2.08