| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d3omze1: 3omz E:13-116 [248317] automated match to d4mayc1 |
PDB Entry: 3omz (more details), 3.04 Å
SCOPe Domain Sequences for d3omze1:
Sequence, based on SEQRES records: (download)
>d3omze1 b.1.1.0 (E:13-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irqtgssaeitcdlaegstgyihwylhqegkapqrllyydsytssvvlesgispgkydty
gstrknlrmilrnliendsgvyycatwdqnyykklfgsgtslvv
>d3omze1 b.1.1.0 (E:13-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irqtgssaeitcdlgyihwylhkapqrllyydsytssvvlepgkydtnlrmilrnliend
sgvyycatwdqnyykklfgsgtslvv
Timeline for d3omze1:
View in 3DDomains from other chains: (mouse over for more information) d3omza1, d3omza2, d3omzc1, d3omzc2 |