PDB entry 3omz

View 3omz on RCSB PDB site
Description: Crystal structure of MICA-specific human gamma delta T cell receptor
Class: immune system
Keywords: Immunoglobulin fold, Immune surveillance of cell stress protein MIC-A/B, MIC-A/B binding, Epithelium, IMMUNE SYSTEM
Deposited on 2010-08-27, released 2011-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: 0.267
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human Vdelta1 gamma delta T cell receptor delta1A/B-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OMZ
    Domains in SCOPe 2.08: d3omza1, d3omza2
  • Chain 'C':
    Compound: human Vdelta1 gamma delta T cell receptor delta1A/B-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OMZ
    Domains in SCOPe 2.08: d3omzc1, d3omzc2
  • Chain 'E':
    Compound: human Vdelta1 gamma delta T cell receptor delta1A/B-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OMZ
    Domains in SCOPe 2.08: d3omze1
  • Chain 'G':
    Compound: human Vdelta1 gamma delta T cell receptor delta1A/B-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OMZ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3omzA (A:)
    mssnlegrtksvirqtgssaeitcdlaegstgyihwylhqegkapqrllyydsytssvvl
    esgispgkydtygstrknlrmilrnliendsgvyycatwdqnyykklfgsgtslvvtdkq
    gsaddakkdaakkdgaqkvtqaqssvsmpvrkavtlnclyetswwsyyifwykrlpskem
    iflirqgsdeqnaksgrysvnfkkaaksvaltisalqledsakyfcalgesltradklif
    gkgtrvtveprsqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3omzA (A:)
    svirqtgssaeitcdlgyihwylhqegkapqrllyydsytssvvlesgispgkydtygsk
    nlrmilrnliendsgvyycatwdqnyykklfgsgtslvvtdqkvtqaqssvsmpvrkavt
    lnclyetswwsyyifwykrlpskemiflirqgsdeqnaksgrysvnfkkaaksvaltisa
    lqledsakyfcalgesltradklifgkgtrvtvep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3omzC (C:)
    mssnlegrtksvirqtgssaeitcdlaegstgyihwylhqegkapqrllyydsytssvvl
    esgispgkydtygstrknlrmilrnliendsgvyycatwdqnyykklfgsgtslvvtdkq
    gsaddakkdaakkdgaqkvtqaqssvsmpvrkavtlnclyetswwsyyifwykrlpskem
    iflirqgsdeqnaksgrysvnfkkaaksvaltisalqledsakyfcalgesltradklif
    gkgtrvtveprsqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3omzC (C:)
    svirqtgssaeitcdlgyihwylhqegkapqrllyydsytssvvlesgispgkydtnlrm
    ilrnliendsgvyycatwdqnyykklfgsgtslvvtdqkvtqssvsmpvrkavtlnclye
    tswwsyyifwykrlpskemiflirqgsdeqnaksgrysvnfkkaaksvaltisalqleds
    akyfcalgesltradklifgkgtrvtvep
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3omzE (E:)
    mssnlegrtksvirqtgssaeitcdlaegstgyihwylhqegkapqrllyydsytssvvl
    esgispgkydtygstrknlrmilrnliendsgvyycatwdqnyykklfgsgtslvvtdkq
    gsaddakkdaakkdgaqkvtqaqssvsmpvrkavtlnclyetswwsyyifwykrlpskem
    iflirqgsdeqnaksgrysvnfkkaaksvaltisalqledsakyfcalgesltradklif
    gkgtrvtveprsqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3omzE (E:)
    irqtgssaeitcdlgyihwylhkapqrllyydsytssvvlepgkydtnlrmilrnliend
    sgvyycatwdqnyykklfgsgtslvvtqkvtqvvtlnclyetswwsyyifwykrlpskem
    iflirqgsdeqnaksgrysvnfkkksvaltiskyfcalgesltradklifgk
    

  • Chain 'G':
    No sequence available.