| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
| Protein automated matches [190158] (18 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (2 PDB entries) |
| Domain d3ojxa1: 3ojx A:67-239 [248310] Other proteins in same PDB: d3ojxa2, d3ojxa3 automated match to d1ja1a2 complexed with fad, fmn, nap |
PDB Entry: 3ojx (more details), 2.5 Å
SCOPe Domain Sequences for d3ojxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ojxa1 c.23.5.0 (A:67-239) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidkslvvfamatygegdptcnaqdfydwlqetdvdltgvkfavfglgnktyehfnamgk
yvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavaeffgveatgee
Timeline for d3ojxa1: