Lineage for d3oeda1 (3oed A:3-294)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335598Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2335876Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 2335880Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 2335881Species Human (Homo sapiens) [TaxId:9606] [48253] (19 PDB entries)
  8. 2335907Domain d3oeda1: 3oed A:3-294 [248211]
    Other proteins in same PDB: d3oeda2, d3oedb2, d3oedc1, d3oedc2, d3oedd1, d3oedd2
    automated match to d1ghqa_

Details for d3oeda1

PDB Entry: 3oed (more details), 3.16 Å

PDB Description: The structure of the complex between complement receptor CR2 and its ligand complement fragment C3d
PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d3oeda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeda1 a.102.4.4 (A:3-294) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq
qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd
gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf
leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy
allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

SCOPe Domain Coordinates for d3oeda1:

Click to download the PDB-style file with coordinates for d3oeda1.
(The format of our PDB-style files is described here.)

Timeline for d3oeda1: