SCOP 1.59: Domain d1ey0a_: 1ey0 A:

Lineage for d1ey0a_ (1ey0 A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (56 PDB entries)

8. Domain d1ey0a_: 1ey0 A: [24817]

Details for d1ey0a_

PDB Entry: 1ey0, 1.6 Å

PDB Description: structure of wild-type s. nuclease at 1.6 a resolution

SCOP Domain Sequences for d1ey0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ey0a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
rkseaqakkeklniws

Timeline for d1ey0a_:

• d1ey0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ey0a_ appears in SCOP 1.57
  
• d1ey0a_ appears in SCOP 1.61
  
• d1ey0a_ appears in the current release, SCOPe 2.08