Lineage for d3o05a_ (3o05 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2436130Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2436131Protein automated matches [190292] (37 species)
    not a true protein
  7. 2436142Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255829] (4 PDB entries)
  8. 2436146Domain d3o05a_: 3o05 A: [248111]
    automated match to d1znna1
    complexed with plp

Details for d3o05a_

PDB Entry: 3o05 (more details), 2.2 Å

PDB Description: Crystal Structure of Yeast Pyridoxal 5-Phosphate Synthase Snz1 Complxed with Substrate PLP
PDB Compounds: (A:) Pyridoxine biosynthesis protein SNZ1

SCOPe Domain Sequences for d3o05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o05a_ c.1.2.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvs
ipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgea
lrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvs
llkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavvea
tthfdnpskllevssdlgelm

SCOPe Domain Coordinates for d3o05a_:

Click to download the PDB-style file with coordinates for d3o05a_.
(The format of our PDB-style files is described here.)

Timeline for d3o05a_: