Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (37 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255829] (4 PDB entries) |
Domain d3o05a_: 3o05 A: [248111] automated match to d1znna1 complexed with plp |
PDB Entry: 3o05 (more details), 2.2 Å
SCOPe Domain Sequences for d3o05a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o05a_ c.1.2.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvs ipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgea lrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvs llkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavvea tthfdnpskllevssdlgelm
Timeline for d3o05a_: