SCOPe 2.08: Domain d3nwyd_: 3nwy D:

Lineage for d3nwyd_ (3nwy D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [255987] (18 PDB entries)

8. Domain d3nwyd_: 3nwy D: [248096]
   automated match to d1z9da1
   complexed with gtp, udp

Details for d3nwyd_

PDB Entry: 3nwy, 2.54 Å

PDB Description: Structure and allosteric regulation of the uridine monophosphate kinase from Mycobacterium tuberculosis

PDB Compounds: (D:) uridylate kinase

SCOPe Domain Sequences for d3nwyd_:

Sequence, based on SEQRES records:

>d3nwyd_ c.73.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sgysrvllklggemfgggqvgldpdvvaqvarqiadvvrggvqiavvigggnffrgaqlq
qlgmertrsdymgmlgtvmnslalqdflekegivtrvqtaitmgqvaepylplravrhle
kgrvvifgagmglpyfstdttaaqraleigadvvlmakavdgvfaedprvnpeaelltav
shrevldrglrvadatafslcmdngmpilvfnlltdgniaravrgekigtlvtt

Sequence, based on observed residues (ATOM records):

>d3nwyd_ c.73.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sgysrvllklggemfgggqvgldpdvvaqvarqiadvvrggvqiavvigggnfqlqqlgm
ertrsdymgmlgtvmnslalqdflekegivtrvqtaitmgqvaepylplravrhlekgrv
vifgagmglpyfstdttaaqraleigadvvlmakavdgvfaedprvnpeaelltavshre
vldrglrvadatafslcmdngmpilvfnlltdgniaravrgekigtlvtt

Timeline for d3nwyd_:

• d3nwyd_ first appeared in SCOPe 2.04
  
• d3nwyd_ appears in SCOPe 2.07