| Class b: All beta proteins [48724] (176 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
| Protein D3 core SNRNP protein [50188] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50189] (1 PDB entry) |
| Domain d1d3bi_: 1d3b I: [24802] Other proteins in same PDB: d1d3bb_, d1d3bd_, d1d3bf_, d1d3bh_, d1d3bj_, d1d3bl_ CASP3 protein/RNA complex; complexed with cit, gol |
PDB Entry: 1d3b (more details), 2 Å
SCOPe Domain Sequences for d1d3bi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3bi_ b.38.1.1 (I:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
irgckirflilpd
Timeline for d1d3bi_: