Lineage for d3nsya1 (3nsy A:30-170)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381153Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2381154Species Escherichia coli [TaxId:562] [69195] (38 PDB entries)
  8. 2381263Domain d3nsya1: 3nsy A:30-170 [248019]
    Other proteins in same PDB: d3nsya4
    automated match to d1kv7a1
    complexed with c2o, cu; mutant

Details for d3nsya1

PDB Entry: 3nsy (more details), 2.1 Å

PDB Description: the multi-copper oxidase cueo with six met to ser mutations (m358s, m361s,m362s,m364s,m366s,m368s)
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3nsya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nsya1 b.6.1.3 (A:30-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
erptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvd
iynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktg
rqvamglaglvvieddeilkl

SCOPe Domain Coordinates for d3nsya1:

Click to download the PDB-style file with coordinates for d3nsya1.
(The format of our PDB-style files is described here.)

Timeline for d3nsya1: