SCOPe 2.08: Domain d3nq0a_: 3nq0 A:

Lineage for d3nq0a_ (3nq0 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.0: automated matches [254307] (1 protein)
   not a true family

6. Protein automated matches [254708] (4 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [255981] (21 PDB entries)

8. Domain d3nq0a_: 3nq0 A: [247994]
   automated match to d2ahka_
   complexed with cu

Details for d3nq0a_

PDB Entry: 3nq0, 2.2 Å

PDB Description: Crystal Structure of Tyrosinase from Bacillus megaterium crystallized in the absence of Zinc

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d3nq0a_:

Sequence; same for both SEQRES and ATOM records:

>d3nq0a_ a.86.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvy

Timeline for d3nq0a_:

• d3nq0a_ first appeared in SCOPe 2.04
  
• d3nq0a_ appears in SCOPe 2.07