Lineage for d1b34b_ (1b34 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123076Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1123077Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1123078Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1123259Protein D2 core SNRNP protein [50186] (1 species)
  7. 1123260Species Human (Homo sapiens) [TaxId:9606] [50187] (1 PDB entry)
  8. 1123261Domain d1b34b_: 1b34 B: [24797]
    Other proteins in same PDB: d1b34a_
    protein/RNA complex

Details for d1b34b_

PDB Entry: 1b34 (more details), 2.5 Å

PDB Description: crystal structure of the d1d2 sub-complex from the human snrnp core domain
PDB Compounds: (B:) protein (small nuclear ribonucleoprotein sm d2)

SCOPe Domain Sequences for d1b34b_:

Sequence, based on SEQRES records: (download)

>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
tgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevpksgkgkk
kskpvnkdryiskmflrgdsvivvlrnpliagk

Sequence, based on observed residues (ATOM records): (download)

>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
tgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemdryiskmflrgd
svivvlrnpliagk

SCOPe Domain Coordinates for d1b34b_:

Click to download the PDB-style file with coordinates for d1b34b_.
(The format of our PDB-style files is described here.)

Timeline for d1b34b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b34a_