Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.0: automated matches [191435] (1 protein) not a true family |
Protein automated matches [190626] (12 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189976] (3 PDB entries) |
Domain d3nipe_: 3nip E: [247941] automated match to d1gq6a_ complexed with 16d |
PDB Entry: 3nip (more details), 2.5 Å
SCOPe Domain Sequences for d3nipe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nipe_ c.42.1.0 (E:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} ndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevr nlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsv ggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplr tvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvd vldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatm mfellcllaesaarsa
Timeline for d3nipe_: