SCOPe 2.07: Domain d3ni8a1: 3ni8 A:19-157

Lineage for d3ni8a1 (3ni8 A:19-157)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [255979] (1 PDB entry)

8. Domain d3ni8a1: 3ni8 A:19-157 [247935]
   Other proteins in same PDB: d3ni8a2
   automated match to d1x53a1
   complexed with gol, ipa

Details for d3ni8a1

PDB Entry: 3ni8, 2.5 Å

PDB Description: crystal structure of pfc0360w, an hsp90 activator from plasmodium falciparum

PDB Compounds: (A:) PFC0360w protein

SCOPe Domain Sequences for d3ni8a1:

Sequence; same for both SEQRES and ATOM records:

>d3ni8a1 d.129.3.0 (A:19-157) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
msfeiteeyyvppevlfnaftdaytltrlsrgslaevdlkvggkfslfsgsilgefteit
kphkivekwkfrdwnecdystvtvefisvkenhtklklthnnipasnkyneggvlerckn
gwtqnflhnievilgypkk

Timeline for d3ni8a1:

• d3ni8a1 first appeared in SCOPe 2.04, called d3ni8a_
  
• d3ni8a1 appears in SCOPe 2.06
  
• d3ni8a1 appears in the current release, SCOPe 2.08