Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [255979] (1 PDB entry) |
Domain d3ni8a1: 3ni8 A:19-157 [247935] Other proteins in same PDB: d3ni8a2 automated match to d1x53a1 complexed with gol, ipa |
PDB Entry: 3ni8 (more details), 2.5 Å
SCOPe Domain Sequences for d3ni8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ni8a1 d.129.3.0 (A:19-157) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} msfeiteeyyvppevlfnaftdaytltrlsrgslaevdlkvggkfslfsgsilgefteit kphkivekwkfrdwnecdystvtvefisvkenhtklklthnnipasnkyneggvlerckn gwtqnflhnievilgypkk
Timeline for d3ni8a1: