Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (12 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255975] (6 PDB entries) |
Domain d3n3ba_: 3n3b A: [247849] automated match to d1uzrb_ complexed with fmn, mn, peo |
PDB Entry: 3n3b (more details), 2.36 Å
SCOPe Domain Sequences for d3n3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n3ba_ a.25.1.2 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} risainwnkisddkdlevwnrltsnfwlpekvplsndipawqtltvveqqltmrvftglt lldtlqnvigapslmpdaltpheeavlsnisfmeavharsyssifstlcqtkdvdaayaw seenaplqrkaqiiqqhyrgddplkkkiasvflesflfysgfwlpmyfssrgkltntadl irliirdeavhgyyigykyqknmekislgqreelksfafdlllelydnelqytdelyaet pwaddvkaflcynankalmnlgyeplfpaemaevnpailaalsp
Timeline for d3n3ba_: