Lineage for d3n37a_ (3n37 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729174Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1729468Protein automated matches [190435] (9 species)
    not a true protein
  7. 1729503Species Escherichia coli K-12 [TaxId:83333] [255975] (6 PDB entries)
  8. 1729504Domain d3n37a_: 3n37 A: [247843]
    automated match to d1uzrb_
    complexed with gol, mn

Details for d3n37a_

PDB Entry: 3n37 (more details), 1.65 Å

PDB Description: Ribonucleotide Reductase Dimanganese(II)-NrdF from Escherichia coli
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 2 subunit beta

SCOPe Domain Sequences for d3n37a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n37a_ a.25.1.2 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
risainwnkisddkdlevwnrltsnfwlpekvplsndipawqtltvveqqltmrvftglt
lldtlqnvigapslmpdaltpheeavlsnisfmeavharsyssifstlcqtkdvdaayaw
seenaplqrkaqiiqqhyrgddplkkkiasvflesflfysgfwlpmyfssrgkltntadl
irliirdeavhgyyigykyqknmekislgqreelksfafdlllelydnelqytdelyaet
pwaddvkaflcynankalmnlgyeplfpaemaevnpailaalsp

SCOPe Domain Coordinates for d3n37a_:

Click to download the PDB-style file with coordinates for d3n37a_.
(The format of our PDB-style files is described here.)

Timeline for d3n37a_: