Lineage for d3mv144 (3mv1 4:626-730)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1521824Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1521825Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1521839Species Escherichia coli [TaxId:562] [49306] (41 PDB entries)
    Uniprot P00722
  8. 1522031Domain d3mv144: 3mv1 4:626-730 [247836]
    Other proteins in same PDB: d3mv111, d3mv113, d3mv115, d3mv121, d3mv123, d3mv125, d3mv131, d3mv133, d3mv135, d3mv141, d3mv143, d3mv145
    automated match to d1jz8a2
    complexed with dms, gai, mg, na

Details for d3mv144

PDB Entry: 3mv1 (more details), 2.2 Å

PDB Description: e.coli (lacz) beta-galactosidase (r599a) in complex with guanidinium
PDB Compounds: (4:) beta-galactosidase

SCOPe Domain Sequences for d3mv144:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mv144 b.1.4.1 (4:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3mv144:

Click to download the PDB-style file with coordinates for d3mv144.
(The format of our PDB-style files is described here.)

Timeline for d3mv144: