| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein beta-Galactosidase [49804] (3 species) |
| Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
| Domain d3mv031: 3mv0 3:13-219 [247808] Other proteins in same PDB: d3mv012, d3mv013, d3mv014, d3mv015, d3mv022, d3mv023, d3mv024, d3mv025, d3mv032, d3mv033, d3mv034, d3mv035, d3mv042, d3mv043, d3mv044, d3mv045 automated match to d1f49a3 complexed with 149, dms, mg, na |
PDB Entry: 3mv0 (more details), 2.2 Å
SCOPe Domain Sequences for d3mv031:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mv031 b.18.1.5 (3:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3mv031:
View in 3DDomains from same chain: (mouse over for more information) d3mv032, d3mv033, d3mv034, d3mv035 |