Lineage for d1qava_ (1qav A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165991Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 165992Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
  5. 165993Family b.36.1.1: PDZ domain [50157] (9 proteins)
  6. 166029Protein Syntrophin [50164] (1 species)
  7. 166030Species Mouse (Mus musculus) [TaxId:10090] [50165] (2 PDB entries)
  8. 166031Domain d1qava_: 1qav A: [24777]
    Other proteins in same PDB: d1qavb_

Details for d1qava_

PDB Entry: 1qav (more details), 1.9 Å

PDB Description: Unexpected Modes of PDZ Domain Scaffolding Revealed by Structure of NNOS-Syntrophin Complex

SCOP Domain Sequences for d1qava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus)}
gslqrrrvtvrkadagglgisikggrenkmpiliskifkglaadqtealfvgdailsvng
edlssathdeavqalkktgkevvlevkymk

SCOP Domain Coordinates for d1qava_:

Click to download the PDB-style file with coordinates for d1qava_.
(The format of our PDB-style files is described here.)

Timeline for d1qava_:

166031
d1qava_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1qavb_