Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (24 species) not a true protein |
Species Clostridium acetobutylicum [TaxId:1488] [255967] (1 PDB entry) |
Domain d3mgka_: 3mgk A: [247703] Other proteins in same PDB: d3mgkb2 automated match to d4k2hd_ |
PDB Entry: 3mgk (more details), 2 Å
SCOPe Domain Sequences for d3mgka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mgka_ c.23.16.0 (A:) automated matches {Clostridium acetobutylicum [TaxId: 1488]} syridvllfnkfetldvfgpveifgnlqddfelnfissdgglvessqkvrvetslytrde niekilfvpggsgtrekvnddnfinfignmvkeskyiisvctgsallskagilngkratt nkrsfkwvteqnedvlwvkearwvkdgniytssgvsagidmtlgfiedligkekaleisr sieyfwnedsnydpfskiy
Timeline for d3mgka_: