Lineage for d3mgka_ (3mgk A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467511Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2467512Protein automated matches [190197] (24 species)
    not a true protein
  7. 2467513Species Clostridium acetobutylicum [TaxId:1488] [255967] (1 PDB entry)
  8. 2467514Domain d3mgka_: 3mgk A: [247703]
    Other proteins in same PDB: d3mgkb2
    automated match to d4k2hd_

Details for d3mgka_

PDB Entry: 3mgk (more details), 2 Å

PDB Description: crystal structure of probable protease/amidase from clostridium acetobutylicum atcc 824
PDB Compounds: (A:) Intracellular protease/amidase related enzyme (ThiJ family)

SCOPe Domain Sequences for d3mgka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgka_ c.23.16.0 (A:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
syridvllfnkfetldvfgpveifgnlqddfelnfissdgglvessqkvrvetslytrde
niekilfvpggsgtrekvnddnfinfignmvkeskyiisvctgsallskagilngkratt
nkrsfkwvteqnedvlwvkearwvkdgniytssgvsagidmtlgfiedligkekaleisr
sieyfwnedsnydpfskiy

SCOPe Domain Coordinates for d3mgka_:

Click to download the PDB-style file with coordinates for d3mgka_.
(The format of our PDB-style files is described here.)

Timeline for d3mgka_: