Lineage for d1e3ja1 (1e3j A:4-142,A:313-351)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 947658Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 947659Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 947780Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 948053Protein Ketose reductase (sorbitol dehydrogenase) [50145] (2 species)
  7. 948067Species Silverleaf whitefly (Bemisia argentifolii) [TaxId:77855] [50146] (1 PDB entry)
  8. 948068Domain d1e3ja1: 1e3j A:4-142,A:313-351 [24765]
    Other proteins in same PDB: d1e3ja2
    CASP4
    complexed with bo3, po4, zn

Details for d1e3ja1

PDB Entry: 1e3j (more details), 2.3 Å

PDB Description: ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly
PDB Compounds: (A:) nadp(h)-dependent ketose reductase

SCOPe Domain Sequences for d1e3ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]}
dnlsavlykqndlrleqrpipepkedevllqmayvgicgsdvhyyehgriadfivkdpmv
igheasgtvvkvgknvkhlkkgdrvavepgvpcrrcqfckegkynlcpdltfcatppddg
nlaryyvhaadfchklpdnXcnvkqlvthsfkleqtvdafeaarkkadntikvmiscrq

SCOPe Domain Coordinates for d1e3ja1:

Click to download the PDB-style file with coordinates for d1e3ja1.
(The format of our PDB-style files is described here.)

Timeline for d1e3ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3ja2