Lineage for d3mbqb_ (3mbq B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427616Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2427617Protein automated matches [191182] (19 species)
    not a true protein
  7. 2427739Species Brucella melitensis [TaxId:359391] [255959] (2 PDB entries)
  8. 2427742Domain d3mbqb_: 3mbq B: [247634]
    automated match to d1sixa_
    complexed with edo, gol, so4

Details for d3mbqb_

PDB Entry: 3mbq (more details), 2.1 Å

PDB Description: Crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from Brucella melitensis, orthorhombic crystal form
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3mbqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mbqb_ b.85.4.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
aptlgiirlehakgldlpayetagsagmdlraavaedrqivllpgrrtlvptglileipq
gyevqirprsglafkngitclntpgtidsdyrgevkvllinlgdddfriergmriaqavf
apviqpkieera

SCOPe Domain Coordinates for d3mbqb_:

Click to download the PDB-style file with coordinates for d3mbqb_.
(The format of our PDB-style files is described here.)

Timeline for d3mbqb_: