Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries) |
Domain d3m3ha1: 3m3h A:1-210 [247585] Other proteins in same PDB: d3m3ha2 automated match to d2aeeb_ complexed with cl |
PDB Entry: 3m3h (more details), 1.75 Å
SCOPe Domain Sequences for d3m3ha1:
Sequence, based on SEQRES records: (download)
>d3m3ha1 c.61.1.0 (A:1-210) automated matches {Bacillus anthracis [TaxId: 261594]} mkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaagleelike hfptveviagtatagiahaawvsdrmdlpmcyvrskakghgkgnqiegkaekgqkvvvve dlistggsaitcvealreagcevlgivsiftyeleagkekleaanvasyslsdysaltev aaekgiigqaetkklqewrknpadeawita
>d3m3ha1 c.61.1.0 (A:1-210) automated matches {Bacillus anthracis [TaxId: 261594]} mkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaagleelike hfptveviagtgiahaawvsdrmdlpmcyvrnqiegkaekgqkvvvvedlistggsaitc vealreagcevlgivsiftyeleagkekleaanvasyslsdysaltevaaekgiigqaet kklqewrknpadeawita
Timeline for d3m3ha1: