Lineage for d1ykfa1 (1ykf A:1-139,A:314-352)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 947658Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 947659Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 947780Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 947979Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 947993Species Thermoanaerobacter brockii [TaxId:29323] [50144] (4 PDB entries)
  8. 947998Domain d1ykfa1: 1ykf A:1-139,A:314-352 [24757]
    Other proteins in same PDB: d1ykfa2, d1ykfb2, d1ykfc2, d1ykfd2
    complexed with nap, zn

Details for d1ykfa1

PDB Entry: 1ykf (more details), 2.5 Å

PDB Description: nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
PDB Compounds: (A:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1ykfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykfa1 b.35.1.2 (A:1-139,A:314-352) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
geffhvndadmnlahlpkeXvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila

SCOPe Domain Coordinates for d1ykfa1:

Click to download the PDB-style file with coordinates for d1ykfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ykfa1: