Lineage for d3ly6b2 (3ly6 B:146-468)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889450Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 1889456Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 1889484Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (3 PDB entries)
    GDP-binding protein
  8. 1889493Domain d3ly6b2: 3ly6 B:146-468 [247549]
    Other proteins in same PDB: d3ly6a1, d3ly6a3, d3ly6a4, d3ly6b1, d3ly6b3, d3ly6b4, d3ly6c1, d3ly6c3, d3ly6c4
    automated match to d1kv3a4
    complexed with atp

Details for d3ly6b2

PDB Entry: 3ly6 (more details), 3.14 Å

PDB Description: Crystal structure of human transglutaminase 2 complex with adenosine 5' Triphosphate
PDB Compounds: (B:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d3ly6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ly6b2 d.3.1.4 (B:146-468) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfedgildiclilldvnpkflk
nagrdcsrrsspvyvgrvgsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk
nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg
dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls
tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky
pegsseereaftranhlnklaek

SCOPe Domain Coordinates for d3ly6b2:

Click to download the PDB-style file with coordinates for d3ly6b2.
(The format of our PDB-style files is described here.)

Timeline for d3ly6b2: