Lineage for d3ly6a3 (3ly6 A:469-585)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768856Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 1768857Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 1768858Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 1768911Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (3 PDB entries)
    GDP-binding protein
  8. 1768926Domain d3ly6a3: 3ly6 A:469-585 [247546]
    Other proteins in same PDB: d3ly6a1, d3ly6a2, d3ly6b1, d3ly6b2, d3ly6c1, d3ly6c2
    automated match to d1kv3a2
    complexed with atp

Details for d3ly6a3

PDB Entry: 3ly6 (more details), 3.14 Å

PDB Description: Crystal structure of human transglutaminase 2 complex with adenosine 5' Triphosphate
PDB Compounds: (A:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d3ly6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ly6a3 b.1.5.1 (A:469-585) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
eetgmamrirvgqsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtky
llnlnlepfseksvplcilyekyrdcltesnlikvrallvepvinsyllaerdlyle

SCOPe Domain Coordinates for d3ly6a3:

Click to download the PDB-style file with coordinates for d3ly6a3.
(The format of our PDB-style files is described here.)

Timeline for d3ly6a3: