| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) ![]() iron-sulfur cluster assembly proteins |
| Family d.224.1.2: NifU/IscU domain [102928] (5 proteins) |
| Protein automated matches [254586] (3 species) not a true protein |
| Species Escherichia coli [TaxId:155864] [255942] (1 PDB entry) |
| Domain d3lvla_: 3lvl A: [247519] Other proteins in same PDB: d3lvlb_ automated match to d1r9pa_ complexed with plp |
PDB Entry: 3lvl (more details), 3 Å
SCOPe Domain Sequences for d3lvla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lvla_ d.224.1.2 (A:) automated matches {Escherichia coli [TaxId: 155864]}
aysekvidhyenprnvgsfdnndenvgsgmvgapacgdvmklqikvndegiiedarfkty
gcgsaiassslvtewvkgksldeaqaikntdiaeelelppvkihcsilaedaikaaiady
kskre
Timeline for d3lvla_: