SCOPe 2.08: Domain d3lgjb1: 3lgj B:1-112

Lineage for d3lgjb1 (3lgj B:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Bartonella henselae [TaxId:38323] [255930] (2 PDB entries)

8. Domain d3lgjb1: 3lgj B:1-112 [247463]
   Other proteins in same PDB: d3lgja2, d3lgjb2
   automated match to d1eqqb_
   complexed with ca

Details for d3lgjb1

PDB Entry: 3lgj, 2.5 Å

PDB Description: Crystal structure of single-stranded binding protein (ssb) from Bartonella henselae

PDB Compounds: (B:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d3lgjb1:

Sequence, based on SEQRES records:

>d3lgjb1 b.40.4.0 (B:1-112) automated matches {Bartonella henselae [TaxId: 38323]}
mlnkvmligylgddpesktmtsgaevvnfrmatfesymnknthqkvektewhsvvvfnph
fakialqylhkgskvyiegklqtrkwqdknghdrytteivlpqykgelhlld

Sequence, based on observed residues (ATOM records):

>d3lgjb1 b.40.4.0 (B:1-112) automated matches {Bartonella henselae [TaxId: 38323]}
mlnkvmligylgddpesktmtsgaevvnfrmatfeektewhsvvvfnphfakialqylhk
gskvyiegklqtrkwqdytteivlpqykgelhlld

Timeline for d3lgjb1:

• d3lgjb1 first appeared in SCOPe 2.04, called d3lgjb_
  
• d3lgjb1 appears in SCOPe 2.07