Lineage for d3l4qb_ (3l4q B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242214Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 2242215Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 2242216Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 2242221Protein automated matches [190936] (6 species)
    not a true protein
  7. 2242232Species Influenza A virus [TaxId:381517] [189222] (10 PDB entries)
  8. 2242249Domain d3l4qb_: 3l4q B: [247333]
    Other proteins in same PDB: d3l4qc_, d3l4qd_
    automated match to d3kwgb_
    complexed with gol

Details for d3l4qb_

PDB Entry: 3l4q (more details), 2.3 Å

PDB Description: structural insights into phosphoinositide 3-kinase activation by the influenza a virus ns1 protein
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d3l4qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4qb_ d.299.1.1 (B:) automated matches {Influenza A virus [TaxId: 381517]}
vpasryltdmtleemsrdwsmlipkqkvagplcirmdqaimdkniilkanfsvifdrlet
lillrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetlqrfa

SCOPe Domain Coordinates for d3l4qb_:

Click to download the PDB-style file with coordinates for d3l4qb_.
(The format of our PDB-style files is described here.)

Timeline for d3l4qb_: