SCOPe 2.07: Domain d3kebc_: 3keb C:

Lineage for d3kebc_ (3keb C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Chromobacterium violaceum [TaxId:536] [255907] (1 PDB entry)

8. Domain d3kebc_: 3keb C: [247148]
   automated match to d2yzhd_
   complexed with cl, so4

Details for d3kebc_

PDB Entry: 3keb, 1.8 Å

PDB Description: thiol peroxidase from chromobacterium violaceum

PDB Compounds: (C:) Probable thiol peroxidase

SCOPe Domain Sequences for d3kebc_:

Sequence, based on SEQRES records:

>d3kebc_ c.47.1.0 (C:) automated matches {Chromobacterium violaceum [TaxId: 536]}
medfwvqygdemlpvigdfprkgdylpsfmlvddqkhdaalesfshtpklivtllsvded
ehagllllretrrfldswphlklivitvdspsslararhehglpniallstlrgrdfhkr
ygvliteyplsgytspaiiladaanvvhyserlantrdffdfdaiekllqegeq

Sequence, based on observed residues (ATOM records):

>d3kebc_ c.47.1.0 (C:) automated matches {Chromobacterium violaceum [TaxId: 536]}
medfwvqygdemlpvigdfprkgdylpsfmlvddqkhdaalesfshtpklivtllsvded
ehagllllretrrfldswphlklivitvdspsslararhehglpniallstlrrdfhkry
gvliteyplsgytspaiiladaanvvhyserlantrdffdfdaiekllqegeq

Timeline for d3kebc_:

• d3kebc_ first appeared in SCOPe 2.04
  
• d3kebc_ appears in SCOPe 2.06
  
• d3kebc_ appears in the current release, SCOPe 2.08